PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009628184.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 424aa    MW: 47633.6 Da    PI: 7.0853
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009628184.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ + ++G g+W+++++  g+ R++k+c++rw +yl
   XP_009628184.1 14 KGLWSPEEDEKLINHISKYGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding461.2e-1467109145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg +++eE+ l++++++ lG++ W+ Ia++++ gRt++++k+ w+
   XP_009628184.1  67 RGTFSQEEENLIIELHAVLGNK-WSQIAARLP-GRTDNEIKNLWN 109
                      899*******************.*********.*********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-27664IPR009057Homeodomain-like
PROSITE profilePS5129425.343965IPR017930Myb domain
SuperFamilySSF466899.73E-3012108IPR009057Homeodomain-like
SMARTSM007171.1E-131363IPR001005SANT/Myb domain
PfamPF002499.3E-161461IPR001005SANT/Myb domain
CDDcd001674.05E-121761No hitNo description
Gene3DG3DSA:1.10.10.603.0E-2565116IPR009057Homeodomain-like
SMARTSM007174.2E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129420.21266116IPR017930Myb domain
PfamPF002491.2E-1367109IPR001005SANT/Myb domain
CDDcd001671.59E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLINHIS KYGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQEEENLIIE LHAVLGNKWS QIAARLPGRT DNEIKNLWNS SIKKKLRQKG  120
IDPNTHKPLS EVENEEKVSA ISKNNEKASE GSSELNFFEA HENSNNGIET EKPKPSSATT  180
MDRYSNNMSA AVAPPTHEFF LNRFVNTHET STTSCNKPLD LASYLSFQHL NYGSNIGLSM  240
SPDTSNILFN SNNPKNSEMV SHHFNSNMST NDNILTSISN SILTSPIAAA SNNSIGTFTS  300
NGSSTSIDQL QRNCSFFDNN AFSWGAADCG KSEKEANIHP SETDPEDIKW SEYLHTQFLP  360
GNSIHNHQIT QDLYREKSGT QFATESSLSS TTWLQNQQQQ PSIQTADLYN KHFQRIPDAF  420
GQFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009628184.10.0PREDICTED: transcription factor MYB86-like
TrEMBLM1BAE00.0M1BAE0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000407740.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-104myb domain protein 61